RICTOR monoclonal antibody (M01), clone 1F3

• Catalog Number: orb2290590
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RICTOR.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1F3
• Tested applications: ELISA, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: RICTOR (NP_689969, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKE
• NCBI: NP_689969
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RICTOR is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to RICTOR on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]

Immunoprecipitation of RICTOR transfected lysate using anti-RICTOR monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RICTOR MaxPab rabbit polyclonal antibody.

RICTOR monoclonal antibody (M01), clone 1F3 Western Blot analysis of RICTOR expression in Hela S3 NE.

Western Blot analysis of RICTOR expression in transfected 293T cell line by RICTOR monoclonal antibody (M01), clone 1F3. Lane 1: RICTOR transfected lysate(29.8 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.52 KDa).