You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579297 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RHOT1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC-P, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RHOT1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 71 kDa |
Target | RHOT1 |
UniProt ID | Q8IXI2 |
Protein Sequence | Synthetic peptide located within the following region: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER |
NCBI | NP_060777 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ARHT1, MIRO1, MIRO-1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. There are several isoforms of RHOT1 that contain this N-terminal peptide sequence. Most isoforms are predicted to range from 66 kDa to 80 kDa.
Host: Rabbit, Target Name: MIRO1, Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: RHOT1, Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: RHOT1, Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: RHOT1, Sample Type: Fetal Lung lysates, Antibody Dilution: 1.0 ug/ml.
mouse brain and human neuroblastoma
Rabbit Anti-RHOT1 Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
RHOT1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb579297 with 1:200 dilution. Western blot was performed using orb579297 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: RHOT1 IP with orb579297 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-RHOT1 antibody Titration: 1 ug/ml, Sample Type: Human A549.
ELISA, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Bovine, Gallus | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating