RHG27 antibody

• Catalog Number: orb326654
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RHG27
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human RHG27
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 94kDa
• Target: ARHGAP27
• UniProt ID: Q6ZUM4
• Protein Sequence: Synthetic peptide located within the following region: SQDKQMLYTNHFTQEQVPVPAPRSIHKSSQDGDTPAQASPPEEKVPAELD
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ARHGAP27 antibody, anti CAMGAP1 antibody, ant
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: RHG27, Sample Type: HepG2 Whole Cell lysates, Antibody Dilution: 1 ug/mL.