RHD antibody

• Catalog Number: orb585523
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RHD
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 31kDa
• Target: RHD
• UniProt ID: B2LR45
• Protein Sequence: Synthetic peptide located within the following region: DYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAMLGA
• NCBI: ACB87205
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RH, Rh4, RH30, RhII, RhPI, DIIIc, RHCED, RHDel, RH
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: RHD, Sample Type: 293T, Antibody dilution: 1.0 ug/ml. RHD is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

Host: Rabbit, Target Name: RHD, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: RHD, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: RHD, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-RHD Antibody, Titration: 1.0 ug/ml, Positive Control: RPMI-8226 Whole Cell. RHD is strongly supported by BioGPS gene expression data to be expressed in RPMI 8226.