You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580834 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RHBDF1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RHBDF1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 97 kDa |
Target | RHBDF1 |
UniProt ID | Q96CC6 |
Protein Sequence | Synthetic peptide located within the following region: KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR |
NCBI | NP_071895 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Dist1, hDist1, C16orf8, EGFR-RS, gene-89, gene-90 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms present from ~95 kDa to ~80 kda and another isoform is present ~54 kDa.
Host: Rabbit, Target Name: RHBDF1, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: RHBDF1, Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: RHBDF1, Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: RHBDF1, Sample Type: 721_B Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/Lane, Gel Concentration: 0.12.
Host: Rabbit, Target: RHBDF1, Positive control (+): Human stomach (ST), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.
WB Suggested Anti-RHBDF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.
Filter by Rating