You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574910 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RGS16 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IF, WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RGS16 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 23kDa |
Target | RGS16 |
UniProt ID | Q5VYN9 |
Protein Sequence | Synthetic peptide located within the following region: DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT |
NCBI | NP_002919 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | RGS-R, A28-RGS14, A28-RGS14P Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target: RGS16, Positive control (+): Human Liver (LI), Negative control (-): HepG2 Cell Lysate (HG), Antibody concentration: 0.5 ug/ml.
WB Suggested Anti-RGS16 Antibody Titration: 1.0 ug/ml, Positive Control: Jurkat cell lysate.
ELISA, IF, IHC-P | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating