You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330265 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Rgs10 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FACS, WB |
Predicted Reactivity | Bovine, Human, Porcine, Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 21kDa |
Target | Rgs10 |
UniProt ID | Q9CQE5 |
Protein Sequence | Synthetic peptide located within the following region: MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPE |
NCBI | NP_080694 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti 2310010N19Rik antibody, anti MGC129414 antibo Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
FACS - Sample type: Bone marrow derived monocytes from mice BV2 cells, Dilution: 1 ug/mL.
WB Suggested Anti-Rgs10 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Mouse Thymus.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating