Rgs10 antibody

• Catalog Number: orb330265
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Rgs10
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FACS, WB
• Predicted Reactivity: Bovine, Human, Porcine, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 21kDa
• Target: Rgs10
• UniProt ID: Q9CQE5
• Protein Sequence: Synthetic peptide located within the following region: MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPE
• NCBI: NP_080694
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti 2310010N19Rik antibody, anti MGC129414 antibo
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

FACS - Sample type: Bone marrow derived monocytes from mice BV2 cells, Dilution: 1 ug/mL.

WB Suggested Anti-Rgs10 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Mouse Thymus.