You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574952 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RFP2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RFP2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 47kDa |
Target | TRIM13 |
UniProt ID | Q5UBW0 |
Protein Sequence | Synthetic peptide located within the following region: DTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAV |
NCBI | NP_001007279 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CAR, LEU5, RFP2, DLEU5, RNF77 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: TRIM13, Sample Tissue: Human DLD1 Whole Cell, Antibody dilution: 1 ug/ml.
Human kidney
Human Lung
Rabbit Anti-TRIM13 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-RFP2 Antibody Titration: 0.125 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Lung.
Filter by Rating