You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331097 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to RETNLB |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RETNLB |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 12kDa |
Target | RETNLB |
UniProt ID | Q9BQ08 |
Protein Sequence | Synthetic peptide located within the following region: CSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVT |
NCBI | NP_115968 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FIZZ1 antibody, anti FIZZ2 antibody, anti HXC Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of A549 Whole Cell tissue using RETNLB antibody
WB Suggested Anti-RETNLB Antibody, Titration: 1.0 ug/ml, Positive Control: A549 Whole Cell.
Filter by Rating