RELB antibody

• Catalog Number: orb329942
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RELB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Human, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse RELB
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 61kDa
• Target: RELB
• UniProt ID: Q04863
• Protein Sequence: Synthetic peptide located within the following region: MPSRRAARESAPELGALGSSDLSSLSLTVSRTTDELEIIDEYIKENGFGL
• NCBI: NP_033072
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti shep antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: RELB, Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: RELB, Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-RELB Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:1562500, Positive Control: NIH/3T3 cell lysate.