RecombinantVEGF165,Rat(CHO-expressed)

• Catalog Number: orb1494660
• Category: Proteins
• Description: Vascular Endothelial Growth Factor (VEGF) is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, Vascular Endothelial Growth Factor (VEGF) plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates Vascular Endothelial Growth Factor (VEGF) in the induction of tumor metastasis and intra-ocular neovascular syndromes. Vascular Endothelial Growth Factor (VEGF) signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• MW: 35-48 kDa, observed by non-reducing SDS-PAGE.
• Protein Sequence: APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIM RIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCD KPRR
• Source: CHO
• Biological Activity: ED50 2.5 x 10ˆ5 units/mg
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant Rat Vascular Endothelial Growth Factor 165 (VEGF165) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rrVEGF165 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Vascular Endothelial Growth Factor, VPF, Folliculo
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.