RecombinantTPO,Mouse

• Catalog Number: orb1494662
• Category: Proteins
• Description: Thrombopoietin (TPO), also known as C-mpl ligand, MGDF and Thpo, is a glycoprotein hormone belonging to the EPO/TPO family. It is expressed mainly in the liver, kidney and skeletal muscle. TPO binds and signals through MLP/C_MPL receptor. It stimulates the proliferation and maturation of megakaryocytes from their committed progenitor cells, and it regulates the production and circulation of platelets. TPO has also been reported to promote the apoptosis of hypoxia-sensitized neurons and to inhibit neuronal differentiation.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE.
• MW: 30-80 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQ LEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTA VPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHGPVNGTHGL FAGTSLQTLEASDISPGAFNKGSLAFNLQGGLPPSPSLAPDGHTPFPPSPALPTTHGSPPQLHPLFPDPSTTMPNSTAPH PVTMYPHPRNLSQET
• Source: CHO
• Biological Activity: ED50 < 2 ng /ml, measured in a proliferation assay using MO7e cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant murine Thrombopoietin (TPO) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Thrombopoietin (TPO) should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Thrombopoietin, Megakaryocyte colony-stimulating f
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml..
• Expiration Date: 6 months from date of receipt.