Cart summary

You have no items in your shopping cart.

RecombinantTPO,His,Rat

RecombinantTPO,His,Rat

Catalog Number: orb1494663

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1494663
CategoryProteins
DescriptionThrombopoietin (TPO), also known as c-Mpl ligand, MGDF and THOP, is a glycoprotein hormone belonging to the EPO/TPO family. It is expressed mainly in the liver, kidney and skeletal muscle. TPO binds and signals through c-Mpl receptor. It stimulates the proliferation and maturation of megakaryocytes from their committed progenitor cells, and it regulates the production and circulation of platelets. TPO has also been reported to promote apoptosis of hypoxia-sensitized neurons and to inhibit neuronal differentiation.Recombinant Rat Thrombopoietin(TPO), His, produced in CHO cells is a polypeptide chain containing 174 amino acids. A fully biologically active molecule, rrTPO has a molecular mass of 22 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Purity> 98% as analyzed by SDS-PAGE.
MW22 kDa, observed by reducing SDS-PAGE.
Protein SequenceSPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQ LEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTA VPSRTSQLLTLNKFHHHHHH
SourceCHO
Biological ActivityThe ED50 as determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be ≤ 0.2 ng/ml, corresponding to a specific activity of ≥ 5 x 10ˆ6 units/mg.
Endotoxins< 0.2 EU/μg, determined by LAL method.
StorageLyophilized recombinant Rat Thrombopoietin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Thrombopoietin should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Alternative namesThrombopoietin, Megakaryocyte colony-stimulating f
Read more...
NoteFor research use only
Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
Expiration Date6 months from date of receipt.