RecombinantPF-4/CXCL4,Human

• Catalog Number: orb1494626
• Category: Proteins
• Description: Platelet factor 4, also known as CXCL4, is expressed in megakaryocytes and stored in the α-granules of platelets. Recombinant human PF-4 is a 7.8 kDa protein containing 70 amino acid residues, including the four highly conserved residues present in CXC chemokines. Platelet factor 4 can be antiproliferative and antiangiogenic, at least in part via interfering with FGF2 and VEGF heparin binding and thus inhibiting their signaling. However, it can also be proinflammatory and proatherogenic through multiple effects on monocytes, macrophages and endothelial cells.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• MW: ~7.8 kDa, observed by non-reducing SDS-PAGE.
• Protein Sequence: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
• Source: HEK 293
• Biological Activity: ED50 < 10 ug/ml, measured by its ability to inhibit human FGF-basic-dependent proliferation of NR6R 3T3 mouse fibroblast cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant human platelet factor 4 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human platelet factor 4 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: PF-4, CXCL4, SCYB4,Platelet Factor-4, CXCL4, Oncos
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.