RecombinantPDGF-DD,Human

• Catalog Number: orb1494670
• Category: Proteins
• Description: PDGF-DD, also known as platelet-derived growth factor D, IEGF and SCDGFB, is asecreted growth factor belonging to the PDGF/VEGFfamily. It is highly expressed in the heart, pancreas, adrenal glands and ovary. PDGF-DD forms functional homodimers that bind and induce PDGF Rβ homodimers and PDGF Rα/β heterodimers that promote intracellular signaling. This plays an important role in the regulation of cell differentiation, migration and survival. It has also been reported that PDGF-DD can induce monocyte and macrophage recruitment, increase interstitial pressure and facilitate wound healing.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE.
• MW: 19-21 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHE VLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR
• Source: CHO
• Biological Activity: ED50 < 5 μg/ml, measured in a cell proliferation assay using 3T3 cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant human PDGF-DD remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human PDGF-DDshould be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: platelet-derived growth factor D, IEGF, SCDGFB
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.