Cart summary

You have no items in your shopping cart.

RecombinantMPIF-1/CCL23,Human

RecombinantMPIF-1/CCL23,Human

Catalog Number: orb1494677

DispatchUsually dispatched within 5-10 working days
$ 200.00
Catalog Numberorb1494677
CategoryProteins
DescriptionMyeloid progenitor inhibitory factor 1 (MPIF-1), also known as Chemokine (C-C motif) ligand 23 (CCL23) is a small cytokine belonging to the CC chemokine family.MPIF-1is predominantly expressed in lung and liver tissue, but is also found in bone marrow and placenta. It is also expressed in some cell lines of myeloid origin. It is highly chemotactic for resting T cells and monocytes and slightly chemotactic for neutrophils. MPIF-1 has been shown to inhibit colony formation of bone marrow myeloid immature progenitors. It has also been attributed to an inhibitory activity on hematopoietic progenitor cells. MPIF-1 is a ligand for the chemokine receptor CCR1.Recombinant human MPIF-1/CCL23 produced in CHO cells is a single polypeptide chain containing 99 amino acids. A fully biologically active molecule, rhMPIF-1/CCL23 has a molecular mass of 12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Purity> 98% as analyzed by SDS-PAGE.
MW12 kDa, observed by reducing SDS-PAGE.
Protein SequenceRVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLESYFETNSECSKP GVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN
SourceCHO
Biological ActivityThe EC50 value of human MPIF-1/CCL23 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR1 cells (human Ga15 and human CCR1 stably expressed in CHO-K1 cells) is less than 2 μg/ml.
Endotoxins< 0.2 EU/μg, determined by LAL method.
StorageLyophilized recombinant humanMPIF-1°CCL23 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human MPIF-1°CCL23 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Alternative namesMPIF-1, CCL23
Read more...
NoteFor research use only
Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
Expiration Date6 months from date of receipt.