RecombinantLIX/CXCL5(88aa),Rat

• Catalog Number: orb1494688
• Category: Proteins
• Description: LPSinduced CXC chemokine (LIX), also known as C-X-C motif chemokine 5(CXCL5), is a small cytokine belonging to the CXC chemokine family that is also known as epithelial-derived neutrophil-activating peptide 78 (ENA-78). It is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. Rat LIX cDNA encodes a 130 aa residue precursor with a predicted 37 aa residue signal peptide and a 93 aa residue mature protein. Among human CXC chemokines, rat LIX is most closely related to human GCP-2 and ENA-78.LIX can signal through the CXCR2 receptor.Recombinant rat LIX/CXCL5 (88aa) produced in CHO cells is a polypeptide chain containing 88 amino acids. A fully biologically active molecule, rrLIX/CXCL5 (88aa) has a molecular mass of 9.6 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 98% as analyzed by SDS-PAGE.
• MW: 9.6 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: APFSAMVATELRCVCLTLAPRINPKMIANLEVIPAGPHCPKVEVIAKLKNQKDNVCLDPQAPLIKKVIQK ILGSENKKTKRNALALVR
• Source: CHO
• Biological Activity: The EC50 value of rat LIX/CXCL5 (88aa) on Caˆ2+ mobilization assay in CHO-K1/G15/rCXCR2 cells (human Ga15 and rat CXCR2 stably expressed in CHO-K1 cells) is less than 3 μg/ml.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant Rat LIX/CXCL5(88aa) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat LIX/CXCL5(88aa) should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: C-X-C motif chemokine 5, Small-inducible cytokine
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.