Cart summary

You have no items in your shopping cart.

RecombinantKGF/FGF-7,Human(CHO-expressed)

RecombinantKGF/FGF-7,Human(CHO-expressed)

Catalog Number: orb1494690

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1494690
CategoryProteins
DescriptionKeratinocyte Growth Factor (KGF), also known as FGF-7 and HBGF-7, is a mitogen factor belonging to the heparin-binding growth factor family. It is expressed mainly by epithelial cells. KGF binds to fibroblast growth factor receptor 2b (FGFR2b) to form a dimeric complex and initiate downstream signals. KGF plays an important role in embryonic development, cell proliferation and differentiation. It has also been reported to function in kidney and lung development, angiogenesis, wound healing and tumor invasion.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
MW16-18 kDa, observed by reducing SDS-PAGE.
Protein SequenceCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIK GVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPM AIT
SourceCHO
Biological ActivityED50 < 1 ng /ml, measured in a proliferation assay using 4MBr5 cells.
Endotoxins< 0.2 EU/μg, determined by LAL method.
StorageLyophilized recombinant human Keratinocyte Growth Factor(rhKGF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Keratinocyte Growth Factor should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Alternative namesFGF7, Keratinocyte Growth Factor, Fibroblast Growt
Read more...
NoteFor research use only
Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
Expiration Date6 months from date of receipt.