RecombinantIL-7,His,Mouse

• Catalog Number: orb1494694
• Category: Proteins
• Description: Interleukin-7 (IL-7), also known as lymphopoietin 1 and pre-B cell factor, is a hematopoietic growth factor belonging to the IL-7/IL-9 family. It is produced by keratinocytes, dendritic cells, hepatocytes, neurons and epithelial cells. IL-7 binds and signals through IL-7 receptor,a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor.IL-7 plays a role in regulating early B cell and T cell development. It is also important for optimal dendritic cell-T cell interaction.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE.
• MW: 8-28kDa, observed by reducing SDS-PAGE.
• Protein Sequence: ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLN RAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSIHHHHHH
• Source: CHO
• Biological Activity: ED50<0.4ng/ml, measured in a cell proliferation assay using 2E8 cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant murine Interleukin-7 (IL-7), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-7 (IL-7), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Interleukin-7, IL7
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.