You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494699 |
---|---|
Category | Proteins |
Description | Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, mediates the activities of eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF). It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release. |
Form/Appearance | Lyophilized after extensive dialysis against PBS. |
Purity | > 95% as analyzed by SDS-PAGE. |
MW | 13~21 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQ KEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV |
Source | CHO |
Biological Activity | ED50 < 0.5 ng/ml, measured in a proliferation assay using TF-1 Cells. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Rat Interleukin-5 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Interleukin-5 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Interleukin-5, IL5 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |