Cart summary

You have no items in your shopping cart.

RecombinantIL-5,Mouse(CHO-expressed)

RecombinantIL-5,Mouse(CHO-expressed)

Catalog Number: orb1494700

DispatchUsually dispatched within 5-10 working days
Contact us for a quotation
Catalog Numberorb1494700
CategoryProteins
DescriptionInterleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, is responsible for the activities attributed to eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF). It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.Recombinant Murine IL-5 is homodimeric protein with molecular weight ranging from 25 to 40 kDa due to glycosylation.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
MW25-40 kDa, observed by non-reducing SDS-PAGE.
Protein SequenceMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQ KEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
SourceCHO
Biological ActivityED50 2×10ˆ6 units/mg.
Endotoxins< 0.2 EU/μg, determined by LAL method.
StorageLyophilized recombinant Murine Interlerkin 5 (IL-5) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmIL-5 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Alternative namesInterleukin-5, IL5
Read more...
NoteFor research use only
Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
Expiration Date6 months from date of receipt.