Cart summary

You have no items in your shopping cart.

RecombinantIL-4,His,Rat

RecombinantIL-4,His,Rat

Catalog Number: orb1494706

DispatchUsually dispatched within 5-10 working days
$ 200.00
Catalog Numberorb1494706
CategoryProteins
DescriptionInterleukin-4 (IL-4), also known as BSF-1 and Lymphocyte stimulatory factor 1, is a secreted cytokine belonging to the IL-4/IL-13 family. It is produced by mast cells, T cells and bone marrow stromal cells. IL-4 signals through two receptor complexes: theIL4Rα/common γ chain and the IL4Rα-IL-13 Rα1 receptor complex. IL-4 regulates T cell and B cell proliferation, survival and gene expression. IL-4 also induces IgG and IgE class switching, and the upregulation of MHC-II production.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Purity> 95% as analyzed by SDS-PAGE.
MW18-22 kDa, observed by reducing SDS-PAGE.
Protein SequenceHGCNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRASRVLRKFYFPRDVPPCLKNKSGVLGELRKLC RGVSGLNSLRSCTVNESTLTTLKDFLESLKSILRGKYLQSCTSMSHHHHHH
SourceCHO
Biological ActivityED50 < 0.2 μg/ml, measured in a proliferationassay using C6 cells.
Endotoxins< 0.2 EU/μg, determined by LAL method.
StorageLyophilized recombinant rat Interleukin-4 (IL-4), Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-4 (IL-4), Hisshould be stable up to 1 week at 4°C or up to 2 months at -20°C.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Alternative namesInterleukin-4, IL4
Read more...
NoteFor research use only
Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
Expiration Date6 months from date of receipt.