RecombinantIL-3,His,Rat

• Catalog Number: orb1494708
• Category: Proteins
• Description: Interleukin-3 (IL-3), also known as MCGF, Multi-CSF, HCGF and P-cell stimulation factor, belongs tothe α-helixfamily of hematopoietic cytokines. It is produced by activated T-cells, mast cells and natural killer cells. IL-3 binds to the IL-3 receptor alpha subunit and recruits the signal-transducing common beta chain. IL-3induced signal transduction results in the survival, differentiation and proliferation of a variety of immune cells, such as macrophages, neutrophils, megakaryocytes, mast cells and hematopoietic stem cells. IL-3 often acts synergistically with other cytokines, such as IL-7, EPO, GM-CSF and IL-6, to exert its simulative function.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE.
• MW: 22-34 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKL KCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVECHHHHHH
• Source: CHO
• Biological Activity: ED50 < 8 ng/ml, measured in a cell proliferation assay using NF S-60 cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant ratInterleukin-3 (IL-3), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-3 (IL-3), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Interleukin-3, IL3
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.