Cart summary

You have no items in your shopping cart.

RecombinantIGF-BP-4,His,Human

RecombinantIGF-BP-4,His,Human

Catalog Number: orb1494644

DispatchUsually dispatched within 5-10 working days
Contact us for a quotation
Catalog Numberorb1494644
CategoryProteins
DescriptionInsulin-like growth factor-binding protein 4 (IGF-BP-4), also known as IBP-4, is a secreted glycoprotein belonging to the IGFBP family. IGF-BP-4 is produced by osteoblasts, epidermis, ovarian follicles and other tissues. It binds both insulin-like growth factor (IGF) I and II, and it circulates in the plasma in both glycosylated and non-glycosylated forms. IGF-BP-4 prolongs the half-life of the IGFs and has been shown to inhibit or stimulate the growth-promoting effects of the IGFs. Pregnancy Associated Plasma Protein A (PAPP-A) proteolytically cleaves IGF-BP-4 and reduces its affinity to bind IGFs, and thus serves as an important regulator of IGF-BP-4 function.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Purity> 95% as analyzed by SDS-PAGE.
MW30-35 kDa, observed by reducing SDS-PAGE.
Protein SequenceDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCM ELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQKHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRA LERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFREHHHHHH
SourceHEK 293
Biological ActivityED50 < 50 ng/ml, measured in a bioassay using FDC-P1 cells in the presence of 15ng/ml human IGF-II.
Endotoxins< 0.2 EU/μg, determined by LAL method.
StorageLyophilized recombinant human IGF-BP-4 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human IGF-BP-4, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Alternative namesInsulin-like Growth Factor-Binding Protein 4, IBP-
Read more...
NoteFor research use only
Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
Expiration Date6 months from date of receipt.