You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494729 |
---|---|
Category | Proteins |
Description | Human HCC4, also named NCC4and Chemokine (C-C motif) ligand 16 (CCL16) is a small cytokine belonging to the CC chemokine family that is known under several pseudonyms, including Liver-expressed chemokine (LEC) and Monotactin-1 (MTN-1). It can signal through the CCR8 and CCR1 receptors, and it is chemotactic towards monocytes and lymphocytes but not neutrophils. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is greatly up-regulated in the presence of IL-10. HCC-4 induces a calcium flux in thp-1 cells that are desensitized prior to the expression of RANTES. Recombinant human HCC‑4/CCL16 produced in CHO cells is a single non-glycosylated polypeptide chain containing 97 amino acids. A fully biologically active molecule, rhHCC‑4/CCL16has a molecular mass of 12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript. |
Form/Appearance | Lyophilized after extensive dialysis against PBS. |
Purity | > 98% as analyzed by SDS-PAGE. |
MW | 12 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLST VKIITAKNGQPQLLNSQ |
Source | CHO |
Biological Activity | The EC50 value of human HCC‑4/CCL16 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR1 cells (human Ga15 and human CCR1 stably expressed in CHO-K1 cells) is less than 1.5 μg/ml. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant human HCC‑4°CCL16 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human HCC‑4°CCL16 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | HCC‑4; CCL16 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |