RecombinantGranzymeB,Mouse

• Catalog Number: orb1494734
• Category: Proteins
• Description: Granzyme B is a serine protease most commonly found in the granules of cytotoxic lymphocytes (CTLs), natural killer cells (NK cells) and cytotoxic T cells. It is secreted by these cells along with the pore forming protein perforin to mediate apoptosis in target cells.Granzyme B has also recently been found to be produced by a wide range of non-cytotoxic cells ranging from basophils and mast cells to smooth muscle cells. The secondary functions of granzyme B are also numerous. Granzyme B has been shown to be involved in inducing inflammation by stimulating cytokine release and is also involved in extracellular matrix remodeling.Recombinant Mouse Granzyme B produced in CHO cells is a polypeptide chain containing 227 amino acids. A fully biologically active molecule, rmGranzyme B has a molecular mass of 32 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 98% as analyzed by SDS-PAGE.
• MW: 32 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: IIGGHEVKPHSRPYMALLSIKDQQPEAICGGFLIREDFVLTAAHCEGSIINVTLGAHNIK EQEKTQQVIPMVKCIPHPDYNPKTFSNDIMLLKLKSKAKRTRAVRPLNLPRRNVNVKPGD VCYVAGWGRMAPMGKYSNTLQEVELTVQKDRECESYFKNRYNKTNQICAGDPKTKRASFR GDSGGPLVCKKVAAGIVSYGYKDGSPPRAFTKVSSFLSWIKKTMKSS
• Source: CHO
• Biological Activity: Measured by its ability to cleave a chromogenic peptide substrate (Ac-IEPD-pNA), the specific activity is greater than 1000 nM/min per μg of enzyme.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant Mouse Granzyme B remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant Mouse Granzyme B should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Granzyme B
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.