RecombinantG-CSF,Human(CHO-expressed)

• Catalog Number: orb1494742
• Category: Proteins
• Description: Human Granulocyte Colony Stimulating Factor (G-CSF) contains internal disulfide bonds. Among the family of colony-stimulating factors, Granulocyte Colony Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation to granulocytes and macrophages of leukemic myeloid cell lines. The synthesis of Granulocyte Colony Stimulating Factor (G-CSF) can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits the synthesis of Granulocyte Colony Stimulating Factor (G-CSF). In epithelial, endothelial, and fibroblastic cells, the secretion of Granulocyte Colony Stimulating Factor (G-CSF) is induced by Interleukin-17.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• MW: 18.7kDa, observed by non-reducing SDS-PAGE.
• Protein Sequence: TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHS GLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSF LEVSYRVLRHLAQP
• Source: CHO
• Biological Activity: ED501 x 10ˆ7 units/mg.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant human Granulocyte Colony Stimulating Factor (G-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhG-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Granulocyte Colony-Stimulating Factor, CSF-3, CSF3
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.