RecombinantFlt-3L,His,Mouse

• Catalog Number: orb1494746
• Category: Proteins
• Description: Flt3L, also known as Fms-related tyrosine kinase 3 ligand and SL cytokine, is a single-pass type I membrane protein. It is expressed by stromal cells and T cells. Flt3L signals through tyrosine kinase receptor Flt3/Flk2 to stimulate the proliferation of early hematopoietic progenitor cells. It synergizes with other growth factors, such as GM-CSF, IL-3 and CSF, to promote the differentiation of both myeloid and lymphoid cells. Alternative splicing and proteolytic cleavage of membrane-bound Flt3L generates a soluble extracellular domain (ECD) isoform with full biological activity.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE.
• MW: 24-30 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEI HFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPR PRHHHHHH
• Source: CHO
• Biological Activity: ED50 < 10 ng /ml, measured in a cell proliferation assay using AML5 cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant murine Flt3L, His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Flt3L, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Fms-related tyrosine kinase 3 ligand, SL cytokine
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.