You have no items in your shopping cart.
Cart summary
RecombinantENA-78/CXCL5,Human(HEK293-expressed)
Catalog Number: orb1494651
| Catalog Number | orb1494651 |
|---|---|
| Category | Proteins |
| Description | Epithelial-derived neutrophil-activating peptide 78 (ENA-78) is a small cytokine belonging to the CXC chemokine family. It is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. Expression of ENA-78 has also been observed in eosinophils, and can be inhibited with the type II interferon,IFN-γ. ENA-78 stimulates the chemotaxis of neutrophils possessing angiogenic properties. It plays a role in reducing sensitivity to sunburn pain in some subjects, and could be a potential target used to understand more about pain in other inflammatory conditions. ENA-78 is well known to have chemotactic and activating functions on neutrophils, mainly during acute inflammatory responses. It can signal through the CXCR2 receptor.Recombinant ENA-78/CXCL5 produced in 293 cells is a single polypeptide chain containing 78 amino acids. rhENA-78/CXCL5 has a molecular mass of 8.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript. |
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Purity | > 98% as analyzed by SDS-PAGE. |
| MW | 8.5 kDa, observed by reducing SDS-PAGE. |
| Protein Sequence | AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEA PFLKKVIQKILDGGNKEN |
| Source | HEK 293 |
| Biological Activity | The EC50 value of human ENA-78/CXCL5 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 200 ng/ml. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
| Storage | Lyophilized recombinant human ENA-78°CXCL5 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human ENA-78°CXCL5 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Alternative names | Epithelial Neutrophil Activating Peptide-78, CXCL5 Read more... |
| Note | For research use only |
| Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
| Expiration Date | 6 months from date of receipt. |
