RecombinantEGF,Rat(CHO-expressed)

• Catalog Number: orb1494752
• Category: Proteins
• Description: Epidermal Growth Factor, a low-molecular-weight polypeptide, is the founding member of the EGF-family of proteins. It can be found in platelets, macrophages, urine, saliva, etc. EGF acts by binding with high affinity to the Epidermal Growth Factor Receptor (EGFR) and stimulating downstream protein tyrosine kinase activity. This signal transduction cascade results in increased intracellular calcium levels and increased rates of glycolysis and protein synthesis. EGF stimulates the growth of many epidermal and epithelial tissues. Pharmaceutical drugs designed to inhibit EGFR have been used to treat certain types of cancer.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• MW: ~6 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
• Source: CHO
• Biological Activity: ED50 < 0.1 ng/ml, measured in a cell proliferation assay using 3T3 cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant Rat Epidermal Growth Factor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Epidermal Growth Factor should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Epidermal Growth Factor
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.