RecombinantDKK-1,Human

• Catalog Number: orb1494896
• Category: Proteins
• Description: Dickkopf related protein 1 (DKK1) is a chemokine that belongs to the DKK protein family, which alsoincludes DKK-2, DKK-3 and DKK-4. DKK-1 was originally identified as a Xenopus head forming molecule that behaves as an antagonist for Wnt signaling. It is one of the most up-regulated genes during androgen-potentiated balding, with DKK-1 messenger RNA up-regulated a few hours after DHT treatment of hair follicles at the dermal papilla in vitro. Neutralizing bodies against DKK-1 reverses DHT effects on outer root sheath keratinocytes. DKK-1 expression is attenuated by L-threonate, a metabolite of ascorbatein vitro. DKK1 promotes LRP6 internalization and degradation as it forms a ternary complex with the cell surface receptor Kremen. DKK1 not only functions as a head inducer during development, but also regulates joint remodeling and bone formation, which indicate sits role in the pathogenesis of rheumatoid arthritis and multiple myeloma.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE.
• MW: 17-22 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEEC GTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIE ETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICK PVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
• Source: Escherichia coli.
• Biological Activity: ED50 < 6 µg/ml, measured in stimulation of alkaline phosphatase activity using CCl-226 cells. Up to 180% stimulation of alkaline phosphatase activity was observed at 10.0 ug/ml.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant human DKK1 (rhDKK1) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhDKK1 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: DKK1
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.