You have no items in your shopping cart.
Cart summary
RecombinantCINC-2α/CXCL3,Rat
Catalog Number: orb1494758
| Catalog Number | orb1494758 |
|---|---|
| Category | Proteins |
| Description | Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as MIP2β (macrophage inflammatory protein 2 beta), or DCIP1 (dendritic cell inflammatory protein1) in mouse, CINC-2 (cytokineinduced neutrophil attractant 2) in rat, or GROγ (growthregulated oncogene gamma) in human. CXCL3 controls migration and adhesion of monocytes and mediates its effects on target cells by interacting with the cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates cerebellar granule neuron precursors toward the internal layers of the cerebellum during cerebellum morphogenesis. CXCL3 is a potential target for medulloblastoma therapy. CXCL3 is regulated transcriptionally by BTG2.Recombinant Rat CINC-2α/CXCL3 produced in CHO cells is a polypeptide chain containing 68 amino acids. A fully biologically active molecule, rrCINC-2α/CXCL3 has a molecular mass of 7.6 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript. |
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Purity | > 98% as analyzed by SDS-PAGE. |
| MW | 7.6 kDa, observed by reducing SDS-PAGE. |
| Protein Sequence | RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKS |
| Source | CHO |
| Biological Activity | The EC50 value of rat CINC‑2α/CXCL3 on Caˆ2+ mobilization assay in CHO-K1/Ga15/rCXCR2 cells (human G15 and ratCXCR2 stably expressed in CHO-K1 cells) is less than 100 ng/ml. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
| Storage | Lyophilized recombinant Rat CINC-2α/CXCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant Rat CINC-2α/CXCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Alternative names | Growth Regulated Protein/Melanoma Growth Stimulato Read more... |
| Note | For research use only |
| Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
| Expiration Date | 6 months from date of receipt. |
