RecombinantBetacellulin,Mouse(HEK293-expressed)

• Catalog Number: orb1494654
• Category: Proteins
• Description: Betacellulin, also known as BTC, belongs to the EGF family of growth factors. It is expressed in many tissues, such as kidney, pancreas and small intestine. Betacellulin is initially synthesized as a membrane-bound precursor containing multiple EGF-like domains in its extracellular region, and is released from the membrane by proteolytic cleavage. BTC is the ligand for EGFR/ErbB receptor tyrosine kinases, and plays a role in cell growth and differentiation. BTC has been reported to promote beta cell growth and differentiation in the pancreas. Pancreas-specific expression of this gene may induce islet neogenesis and remediate hyperglycemia in type I diabetes.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• MW: 19-24 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY
• Source: HEK 293
• Biological Activity: ED50 < 0.08ng/ml, measured in a cell proliferation assay using 3T3 cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant murine Betacellulin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine Betacellulin should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: BTC
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.