RecombinantBDNF,Human

• Catalog Number: orb1494759
• Category: Proteins
• Description: BDNF, also known as brain-derived neurotrophic factor and abrineurin, is a neurotrophin belonging to the NGF-beta family. It is expressed highly in the brain, and moderately in the heart, lung, skeletal muscle and placenta. BDNF signals through its high affinity receptor gp145/trkB to exert neurotrophic properties. It has been shown to be involved in the survival and differentiation of both the central and peripheral nervous system. Specifically, BDNF regulates synaptic transmission, axonal growth and path-finding, as well as dendritic growth and morphology.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE.
• MW: 12-14kDa, observed by reducing SDS-PAGE.
• Protein Sequence: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
• Source: CHO
• Biological Activity: ED50<4μg/ml, measured in a bioassay using C6 cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant human BDNF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human BDNF should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: brain-derived neurotrophic factor, abrineurin
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.