RecombinantAmphiregulin,Human

• Catalog Number: orb1494656
• Category: Proteins
• Description: Amphiregulin is a member of the EGF family of cytokines, which comprises at least ten proteins including EGF, TGF-α, HB-EGF, Epiregulin, Tomoregulin, Neuregulins and the various heregulins. Through the EGF/TGF-α receptor, it stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulin’s extracellular domain is proteolytically processed to release the mature protein.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE.
• MW: 15~20 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER CGEKSMKTHSMIDSSLSK
• Source: HEK 293
• Biological Activity: ED50 < 0.2 ng/ml, measured in a cell proliferation assay using 3T3 cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant Human Amphiregulin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Amphiregulin should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: AR, AREG, Colorectum cell-derived growth factor (C
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.