You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494658 |
---|---|
Category | Proteins |
Description | WISP-1, also known as Wnt-1-inducible-signaling pathway protein 1, CCN4 and Wnt-1-induced secreted protein, is a cysteine-rich heparin-binding Glycoprotein belonging to the CCN protein family. It is expressed in many internal organs, such as the lung, kidney and spleen. WISP-1 binds to BMP-2 and enhances mesenchymal cell proliferation and osteoblastic differentiation. , WISP-1 has also been reported to attenuate p53-mediated apoptosis and inhibit TNF-induced cell death, suggesting it may play a role intumorigenesis. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 44-46 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | TALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCD YSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQ WVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVD IHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKYCGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFC NLSCRNPNDIFADLESYPDFSEIAN |
Source | CHO |
Biological Activity | ED50<0.5 μg/ml, measured in a bioassay using ATDC5 cells in the presence of 50 ng/ml human BMP-2. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant human WISP-1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human WISP-1 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | WNT1-inducible-signaling pathway protein 1, CCN4 a Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
ELISA, WB | |
Greater than 90% by SDS-PAGE gel analyses | |
43.9 kDa | |
E.Coli |
Filter by Rating