You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494659 |
---|---|
Category | Proteins |
Description | Vascular Endothelial Growth Factor (VEGF)-D, also known as c-Fos-induced growth factor (FIGF), is a member of the PDGF/VEGF growth factor family. It is expressed highly in lung, heart and small intestine, and at lower levels in skeletal muscle, colon and pancreas. It binds to VEGFR-2 and VEGFR-3 receptors and activates downstream signals. VEGF-D is a growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth. It is involved in many developmental and physiological processes including the formation of venous and lymphatic vascular systems during embryogenesis and the maintenance of differentiated lymphatic endothelium in adults. In tumor pathology, it has been reported to play a role in restructuring of lymphatic channels and regional lymph node metastasis. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 18-19 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEI SVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR |
Source | CHO |
Biological Activity | ED50 < 1 μg /ml, measured in a cell proliferation assay using HUVEC cells. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human VEGF-D remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human VEGF-D should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Vascular Endothelial Growth Factor-D, FIGF Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
Human cells |
> 95% by SDS-PAGE. | |
KMP1636, Recombinant Human VEGF-D Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Phe93-Ser201) of human VEGF-D (Accession #O43915) fused with a 6×His Tag at the C-terminus. |
16~19 kDa, observed by reducing SDS-PAGE. | |
HEK 293 |
Filter by Rating