Recombinant VEGF-C, Human

• Catalog Number: orb1494619
• Category: Proteins
• Description: Vascular endothelial growth factor C (VEGF-C) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family, is active in angiogenesis, lymphangiogenesis and endothelial cell growth and survival, and can also affect the permeability of blood vessels. VEGF-C is expressed in various tissues, however it is not produced in peripheral blood lymphocytes. It forms cell surface-associated non-covalent disulfide linked homodimers, and can bind and activate both VEGFR-2 (flk1) and VEGFR-3 (flt4) receptors. The structure and function of VEGF-C is similar to those of vascular endothelial growth factor D (VEGF-D).Recombinant human VEGF-C produced in HEK293 cells is a polypeptide chain containing 126 amino acids. A fully biologically active molecule, rhVEGF-C has a molecular mass of 16-19 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: 16~19 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: MAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITV PLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
• Source: HEK 293
• Biological Activity: Measured in a cell proliferation assay using HMVEC human microvascular endothelial cells. The ED50 for this effect is < 0.5 µg/mL.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant Human Vascular Endothelial Growth Factor C remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Vascular Endothelial Growth Factor C should be stable up to 1 week at 4°C or up to 3 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Flt4 ligand, VRP
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.