You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494619 |
---|---|
Category | Proteins |
Description | Vascular endothelial growth factor C (VEGF-C) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family, is active in angiogenesis, lymphangiogenesis and endothelial cell growth and survival, and can also affect the permeability of blood vessels. VEGF-C is expressed in various tissues, however it is not produced in peripheral blood lymphocytes. It forms cell surface-associated non-covalent disulfide linked homodimers, and can bind and activate both VEGFR-2 (flk1) and VEGFR-3 (flt4) receptors. The structure and function of VEGF-C is similar to those of vascular endothelial growth factor D (VEGF-D).Recombinant human VEGF-C produced in HEK293 cells is a polypeptide chain containing 126 amino acids. A fully biologically active molecule, rhVEGF-C has a molecular mass of 16-19 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 16~19 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | MAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITV PLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR |
Source | HEK 293 |
Biological Activity | Measured in a cell proliferation assay using HMVEC human microvascular endothelial cells. The ED50 for this effect is < 0.5 µg/mL. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human Vascular Endothelial Growth Factor C remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Vascular Endothelial Growth Factor C should be stable up to 1 week at 4°C or up to 3 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Flt4 ligand, VRP Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
Human cells |
> 92% by SDS-PAGE. | |
KMP1367, Recombinant human VEGF-C/Flt4-L/VRP Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Thr103-Arg227) of human VEGF-C/Flt4-L/VRP (Accession #NP_005420.1) fused with a 6×His Tag at the C-terminus. |
ELISA, WB | |
Greater than 95% by SDS-PAGE gel analyses | |
22.5 kDa | |
HEK 293 cells |
Filter by Rating