You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494661 |
---|---|
Category | Proteins |
Description | TWEAK, short for TNF-related weak inducer of apoptosis, is also known as TNFSF12 and DR3LG. It is a type II transmembrane protein belonging to the TNF superfamily. It is expressed widely in many tissues, such as the heart, skeletal muscle, spleen and peripheral blood. Binding of TWEAK to its receptor TWEAKR induces NF-κB activation, chemokine secretion and apoptosis in certain cell types. TWEAK has also been reported to promote endothelial cell proliferation and migration, thus serving as a regulator of angiogenesis. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 20-22 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | RKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLK LDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
Source | CHO |
Biological Activity | ED50 < 1 ng/ml, measured in a cell cytotoxicity assay using HTB-38 (HT-29) cells. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human TWEAK remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human TWEAK should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | TNF-related weak inducer of apoptosis, TNFSF12, DR Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
> 95% as determined by SDS-PAGE and HPLC. | |
5.6 kDa | |
E.Coli |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 43.3 kDa after removal of the signal peptide. | |
Mammalian |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Greater than 90% as determined by SDS-PAGE. | |
38.9 kDa | |
E.coli |
ELISA | |
> 98% as determined by SDS-PAGE. Ni-NTA chromatography. | |
Escherichia coli |
Filter by Rating