You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494622 |
---|---|
Category | Proteins |
Description | TRAIL Receptor-2 is a cell-surface receptor involved in tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced cell-death signaling. The death ligand TRAIL bears high potential as a new anticancer agent, as binding to the death receptors TRAIL-R1 or TRAIL-R2 triggers apoptosis in most cancer cells. TRAIL-R2 is associated with a decrease in the survival rates of breast cancer patients. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | ~15 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTR NTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE |
Source | HEK 293 |
Biological Activity | ED50 < 6 ng/ml, measured in a cell proliferation assay using RPMI-8226 cells in the presence of 25 ng/ml of human TRAIL. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human TRAIL Receptor-2 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human TRAIL Receptor-2 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | soluble TRAIL Receptor-2, DR5, TNFRSF10B, KILER, T Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating