You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494623 |
---|---|
Category | Proteins |
Description | Tyrosine kinase receptor A (Trk-A) is a member of the neurotrophic tyrosine kinase receptor family which includes three members: Trk-A, Trk-B and Trk-C. Trk-A is involved in the development and maturation of the central and peripheral nervous systems through regulation of proliferation, differentiation and survival of sympathetic neurons. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 65~85 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | APCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHF TPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGV PTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGR AEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTH VNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDP |
Source | HEK 293 |
Biological Activity | ED50 < 1 μg/ml, measured in a neutralization assay in the presence of 10 ng/ml human β-NGF using TF-1 Cells. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human Tyrosine kinase receptor A remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Tyrosine kinase receptor A should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Trk-A, NTRK1, MTC, TRK, TRKA Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating