You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494665 |
---|---|
Category | Proteins |
Description | Thymus Chemokine‑1, also called Chemokine (C-X-C motif) ligand 7 (CXCL7) , is a member of the CXC chemokines. Similar to other ELR domain containing CXC chemokines such as IL-8 and the GRO proteins, Thymus Chemokine‑1 has been shown to bind CXCR-2 and be a chemoattractant forneutrophils and play a role in their activation. Although CTAP-III, β-TG and PBP represent amino-terminal extended variants of Thymus Chemokine‑1 and possess the same CXC chemokine domains, these proteins do not exhibit Thymus Chemokine‑1 activity. Recently, it has been shown that the additional amino-terminal residues of CTAP-III mask the critical ELR receptor binding domain that is exposed on Thymus Chemokine‑1 and may account for lack of Thymus Chemokine‑1 activity. Rat CXCL7 shares 72% amino acid sequence identity with mouse CXCL7.Recombinant rat Thymus Chemokine‑1/ CXCL7 produced in CHO cells is a polypeptide chain containing 62 amino acids. A fully biologically active molecule, rrThymus Chemokine‑1/CXCL7 has a molecular mass of 9.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 9.8 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI |
Source | CHO |
Biological Activity | The EC50 value of rat Thymus Chemokine‑1/CXCL7 on Caˆ2+ mobilization assay in CHO-K1/Gα15/rCXCR2 cells (human Gα15 and rat CXCR2 stably expressed in CHO-K1 cells) is less than 300 ng/ml. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Rat Thymus Chemokine‑1°CXCL7 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Thymus Chemokine‑1°CXCL7 should be stable up to 1 week at 4°C or up to 3 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Thymus Chemokine-1,TCK-1, TCK1 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating