Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)

• Catalog Number: orb1785093
• Category: Proteins
• Description: Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)
• Tag: N-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 11.7 kDa
• UniProt ID: Q6MG58
• Protein Sequence: QRMRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN
• Protein Length: Full Length of Mature Protein
• Source: Yeast
• Biological Origin: Rattus norvegicus (Rat)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 5 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA2HU). The EC50 is 4.245-5.843 μg/mL.
• Expression Region: 20-108aa
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.