You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1785093 |
---|---|
Category | Proteins |
Description | Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 11.7 kDa |
UniProt ID | Q6MG58 |
Protein Sequence | QRMRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN |
Protein Length | Full Length of Mature Protein |
Source | Yeast |
Biological Origin | Rattus norvegicus (Rat) |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 5 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA2HU). The EC50 is 4.245-5.843 μg/mL. |
Expression Region | 20-108aa |
Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating