You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494670 |
---|---|
Category | Proteins |
Description | PDGF-DD, also known as platelet-derived growth factor D, IEGF and SCDGFB, is asecreted growth factor belonging to the PDGF/VEGFfamily. It is highly expressed in the heart, pancreas, adrenal glands and ovary. PDGF-DD forms functional homodimers that bind and induce PDGF Rβ homodimers and PDGF Rα/β heterodimers that promote intracellular signaling. This plays an important role in the regulation of cell differentiation, migration and survival. It has also been reported that PDGF-DD can induce monocyte and macrophage recruitment, increase interstitial pressure and facilitate wound healing. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 19-21 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHE VLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR |
Source | CHO |
Biological Activity | ED50 < 5 μg/ml, measured in a cell proliferation assay using 3T3 cells. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant human PDGF-DD remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human PDGF-DDshould be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | platelet-derived growth factor D, IEGF, SCDGFB Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating