You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494672 |
---|---|
Category | Proteins |
Description | Nephroblastoma Overexpressed Gene Protein (NOV), also known as CCN3, IGFBP9 and NOVH, is one of the CCN family of secreted proteins. It is expressed in bone marrow, thymic cells and nephroblastoma. NOV signals through integrin receptors, NOTCH1 and fibulin 1c to regulate multiple cellular activities, such as cell adhesion, migration, proliferation and differentiation. The reported functions of NOV are diverse. It has been reported to play a role in angiogenesis and stem cell self-renewal. It has also been implicated in osteogenic differentiation, embryo development and cancer pathogenesis. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 20-50 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | TQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCV FDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRP EATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSL KAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELK TTRGKM |
Source | CHO |
Biological Activity | ED50 < 5 μg/ml, measured in a cell proliferation assay using 3T3 cells. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human NOV remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human NOV should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Nephroblastoma Overexpressed gene, CCN3, IGFBP9, N Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
> 95% as determined by SDS-PAGE and HPLC. | |
36.2 kDa | |
E.Coli |
Greater than 90% as determined by SDS-PAGE. | |
20.3 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
33.3 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
22.3 kDa | |
E.coli |
SDS-PAGE | |
Unconjugated | |
> 95% by SDS-PAGE and HPLC analyses | |
36.2 kDa |
Filter by Rating