You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494675 |
---|---|
Category | Proteins |
Description | Neuroserpin is an inhibitory serpin that is expressed predominantly in central nervous system. Although the physiological target of neuroserpin is still unclear, cumulative evidence suggest that it plays an important role in controlling proteolytic degradation of extracellular matrix (ECM) during synaptogenesis and the subsequent development of neuronal plasticity. In the adult brain, neuroserpin is secreted from the growth cones of neurons in areas where synaptic changes are associated with learning and memory, i.e. cerebral cortex, hippocampus, and amygdala. The neuroprotective role of neuroserpin has been demonstrated in transgenic mice lacking neuroserpin expression. The deficiency of neuroserpin in these mice was associated with motor neuron disease characterized by axonal degradation. In humans, defects in neuroserpin, caused by point mutations in the neuroserpin gene, underlie a hereditary disorder called the familial encephalopathy with neuroserpin inclusion bodies (FENIB). |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 40-45 kDa, observed by non-reducing SDS-PAGE. |
Protein Sequence | TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNM VTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAAT YLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLV LSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKA IHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL |
Source | CHO |
Biological Activity | ED50 500 units/mg. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human Neuroserpin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rh_Neuroserpin should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Serpin I1, Protease inhibitor 12 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
> 95 % by SDS-PAGE and HPLC analyses. | |
Approximately 44.7 kDa, a single non-glycosylated polypeptide chain containing 394 amino acid residues. | |
Escherichia coli |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
42.2 kDa | |
E.Coli |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
43.2 kDa | |
E.Coli |
Filter by Rating