You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494630 |
---|---|
Category | Proteins |
Description | Macrophage Inflammatory Protein-3 (MIP-3α), also known as chemokine (C-C motif) ligand 20 (CCL20) or liver activation regulated chemokine (LARC), is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. MIP-3αis implicated in the formation and function of mucosal lymphoid tissues via chemoattraction of lymphocytes and dendritic cells toward the epithelial cells surrounding these tissues. MIP-3αis expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor.Recombinant rat MIP-3 α/CCL20 produced in HEK293 cells is a polypeptide chain containing 71 amino acids. A fully biologically active molecule, rrMIP-3 α/CCL20 has a molecular mass of 8.2 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 8.2 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | ASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRIL HLLSLRTKKM |
Source | HEK 293 |
Biological Activity | The EC50 value of rat MIP-3 α/CCL20 on Caˆ2+ mobilization assay in CHO-K1/ G15/rCCR6 cells (human G15 and rat CCR6 stably expressed in CHO-K1 cells) is less than 0.6 μg/ml. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Rat MIP-3 α/CCL20 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant Rat MIP-3 α/CCL20 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | MIP3α, MIP-3 alpha, CCL20 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating