You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494686 |
---|---|
Category | Proteins |
Description | Chemokine (C-C motif) ligand 7 (CCL7) is a small cytokine that was previously called monocyte-specific chemokine 3 (MCP-3). Due to CCL7 possessing two adjacent N-terminal cysteine residues in its mature form, it is classified within the subfamily of chemokines known as CC chemokines. CCL7 specifically attracts monocytes, and regulates macrophage function. It is produced by certain tumor cell lines and by macrophages. This chemokine is located on chromosome 17 in humans, within a large cluster containing many other CC chemokines and is most closely related to CCL2. CCL7 can signal through the CCR1, CCR2 and CCR3 receptors.Recombinant Mouse MCP‑3/MARC/CCL7 produced in CHO cells is a polypeptide chain containing 74 amino acids. A fully biologically active molecule, rmMCP 3/CCL7 has a molecular mass of 8-12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 8~12 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEE AIAYLDMKTPTPKP |
Source | CHO |
Biological Activity | The EC50 value of mouse MCP 3 MARC/CCL7 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/mCCR2 cells (human Gα15 and mouse CCR2 stably expressed in CHO-K1 cells) is less than 1 μg/ml. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Mouse MCP‑3/MARC/CCL7 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse MCP‑3/MARC/CCL7 should be stable up to 1 week at 4°C or up to 3 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Small inducible cytokine A7, CCL7, Monocyte chemot Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating