Recombinant Macaca Gastric inhibitory polypeptide receptor(GIPR), partial (Active)

• Catalog Number: orb1881857
• Category: Proteins
• Description: Recombinant Macaca Gastric inhibitory polypeptide receptor(GIPR), partial (Active)
• Tag: N-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 14.5 kDa
• UniProt ID: A0A2K5VD75
• Protein Sequence: GSEGQTAGELYQRWERYRRECQETLATAEPPSGLACNGSFDMYVCWNYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
• Protein Length: Partial
• Source: Yeast
• Biological Origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GIPR at 2 μg/mL can bind Anti-GIPR recombinant antibody (CSB-RA009438MA1HU). The EC50 is 12.66-13.86 ng/mL.
• Expression Region: 26-138aa
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl,0.5 M NaCl,250mM Imidazole 6% Trehalose, pH 8.0
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.