Recombinant M-CSF, Mouse

• Catalog Number: orb1494683
• Category: Proteins
• Description: Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages[1]. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells[2]. M-CSF interaction with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of of several diseases, including breast and endometrial cancers [1][3][4] .
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: 35-44 kDa, observed by non-reducing SDS-PAGE.
• Protein Sequence: KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERL QELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
• Source: CHO
• Biological Activity: ED50 3.3×10ˆ5 units/mg.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant murine Macrophage-Colony Stimulating Factor (M-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Macrophage Colony Stimulating Factor, CSF-1, Lanim
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.